PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf05912g01012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ARF
Protein Properties Length: 876aa    MW: 97461.5 Da    PI: 6.7408
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf05912g01012.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B356.26.4e-18146272199
                               EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE...........................EE CS
                        B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliy.........................rk 54 
                               f+k+lt sd++++g +++ +++a+e+      + + + +++l+ +d++g++W++++i+                         r+
  Niben101Scf05912g01012.1 146 FCKTLTASDTSTHGGFSVLRRHADEClppldmSRQ-PPTQELVAKDLHGNEWRFRHIFrddligsvkgewrswltnfcfckigRG 229
                               99*****************************7333.34459********888888888888888888888888888888999999 PP

                               ETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                        B3  55 ksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                               +++r++l++GW+ Fv++++L +gD ++F   + +++el+v+v+r+
  Niben101Scf05912g01012.1 230 QPRRHLLQSGWSVFVSSKRLVAGDAFIFL--RGENGELRVGVRRA 272
                               9999*************************..449999*****996 PP

2Auxin_resp123.31.8e-40297379183
                Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                               a+ha++tk++F+v+Y+Pr+s++eF+v+++++++++k+++s+GmRfkm+fe+e+++e+r++Gt+vg++d+dp rWp+SkWr+Lk
  Niben101Scf05912g01012.1 297 AWHAIQTKTMFTVYYKPRTSPAEFIVPYDQYMESMKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGTEDSDPKRWPESKWRCLK 379
                               89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.5E-37140286IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.67E-35142300IPR015300DNA-binding pseudobarrel domain
CDDcd100173.19E-17144271No hitNo description
PROSITE profilePS5086310.25146273IPR003340B3 DNA binding domain
SMARTSM010192.3E-13146273IPR003340B3 DNA binding domain
PfamPF023628.8E-9215272IPR003340B3 DNA binding domain
PfamPF065071.6E-37297379IPR010525Auxin response factor
PfamPF023092.0E-10740835IPR033389AUX/IAA domain
SuperFamilySSF542771.47E-12745827No hitNo description
PROSITE profilePS5174524.955750834IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009737Biological Processresponse to abscisic acid
GO:0009911Biological Processpositive regulation of flower development
GO:0010047Biological Processfruit dehiscence
GO:0010150Biological Processleaf senescence
GO:0010227Biological Processfloral organ abscission
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 876 aa     Download sequence    Send to blast
MATSEVSIKG YNEPIDGSRP VSETVRSAPV VGKVDAETAL YTELWRACAG PLVTVPREGE  60
LVYYFPQGHI EQVEASTNQV ADQQMPLYNL PSKILCRVVN VLLKAEPDTD EVFAQVTLMP  120
EPNQDENTVK KESMRPPTPR FHVHSFCKTL TASDTSTHGG FSVLRRHADE CLPPLDMSRQ  180
PPTQELVAKD LHGNEWRFRH IFRDDLIGSV KGEWRSWLTN FCFCKIGRGQ PRRHLLQSGW  240
SVFVSSKRLV AGDAFIFLRG ENGELRVGVR RAMRQQGIAP SSVISSHSMH LGVLATAWHA  300
IQTKTMFTVY YKPRTSPAEF IVPYDQYMES MKNNYSIGMR FKMRFEGEEA PEQRFTGTIV  360
GTEDSDPKRW PESKWRCLKV RWDENSTTLR PDRVSPWKIE PALSPPALNA PPIARPKRPR  420
SSILPSSPDS SVLTREGSSR ITADPSQASG FSRVLQGQEL STLRGGFAES NDSDVPEKPM  480
LWPPSVDDEK IDVHSVSKRY LSDKWLPLGR LESSLTDLLS GFGVQNNSSH GFCLPSVDQT  540
AFGASLVKRQ AQDQEKDFSL LGKPWSLLSS SLSLDLMDSG SKAPGQGADT PYQMQGDARY  600
SGFGEFSVLP GHRVDNQQGS WLMPQSVSPY FQLSSHSRDL MHKPTVVQKP EAVKPKEGNC  660
KLFGIPLASN VCTDPVMTRK SSLMDSASNM NIGINSHQSP ATDSDQRSEQ SKGSKVLDDG  720
ITASDQDKQF HTSHLTARDR DAKGHSSSTR SCTKVHKQGT ALGRSVDLAK FNNYDELIAE  780
LDQIFDFNGA LKARSKSWLV VYTDDEGDMM LVGDDPWQEF CGMVRKIFIY TKEEVQRMNP  840
GTLNSKGEDT SSVAEGSEAK EVKSLQHPSE SGQEES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1673940118354Auxin response factor 1
4ldw_A1e-1673940118354Auxin response factor 1
4ldw_B1e-1673940118354Auxin response factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00574DAPTransfer from AT5G62000Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009769542.10.0PREDICTED: auxin response factor 2-like isoform X1
RefseqXP_016476812.10.0PREDICTED: auxin response factor 2-like
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLM1B4690.0M1B469_SOLTU; Auxin response factor
STRINGPGSC0003DMT4000367650.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA26182444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2